Recombinant Human SPTA1 protein, His-tagged

• Cat.No.: SPTA1-4571H
• Product Overview: Recombinant Human SPTA1 protein(P02549)(53-474aa), fused to N-terminal His tag, was expressed in Insect cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• ProteinLength: 53-474aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.7 kDa
• AA Sequence: YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SPTA1 spectrin, alpha, erythrocytic 1 (elliptocytosis 2) [ Homo sapiens ]
• Official Symbol: SPTA1
• Synonyms: SPTA1; spectrin, alpha, erythrocytic 1 (elliptocytosis 2); spectrin alpha chain, erythrocyte; EL2; alpha-I spectrin; erythroid alpha-spectrin; HPP; HS3; SPH3; SPTA
• Gene ID: 6708
• mRNA Refseq: NM_003126
• Protein Refseq: NP_003117
• MIM: 182860
• UniProt ID: P02549