Recombinant Human SPRYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRYD7-6167H |
Product Overview : | C13orf1 MS Standard C13 and N15-labeled recombinant protein (NP_065189) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SPRYD7 (SPRY Domain Containing 7) is a Protein Coding gene. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ] |
Official Symbol | SPRYD7 |
Synonyms | SPRYD7; SPRY domain containing 7; C13orf1, chromosome 13 open reading frame 1; SPRY domain-containing protein 7; CLLD6; CLL deletion region gene 6 protein; chronic lymphocytic leukemia deletion region gene 6 protein; C13orf1; |
Gene ID | 57213 |
mRNA Refseq | NM_020456 |
Protein Refseq | NP_065189 |
MIM | 607866 |
UniProt ID | Q5W111 |
◆ Recombinant Proteins | ||
SPRYD7-1420C | Recombinant Chicken SPRYD7 | +Inquiry |
SPRYD7-1769HF | Recombinant Full Length Human SPRYD7 Protein, GST-tagged | +Inquiry |
SPRYD7-519H | Recombinant Human SPRYD7 Protein, GST-tagged | +Inquiry |
SPRYD7-6167H | Recombinant Human SPRYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRYD7-5725R | Recombinant Rat SPRYD7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRYD7-200HCL | Recombinant Human SPRYD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRYD7 Products
Required fields are marked with *
My Review for All SPRYD7 Products
Required fields are marked with *
0
Inquiry Basket