Recombinant Human SPRYD7 Protein, GST-tagged

• Cat.No.: SPRYD7-519H
• Product Overview: Human C13orf1 full-length ORF ( AAH22519.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.01 kDa
• AA Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: SPRYD7
• Synonyms: CLLD6; C13orf1
• Gene ID: 57213
• UniProt ID: Q5W111.2