Recombinant Human SPRED2 protein, His-tagged

• Cat.No.: SPRED2-7855H
• Product Overview: Recombinant Human SPRED2 protein(122-214 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 122-214 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: LIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEI
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SPRED2 sprouty-related, EVH1 domain containing 2 [ Homo sapiens ]
• Official Symbol: SPRED2
• Synonyms: SPRED2; sprouty-related, EVH1 domain containing 2; sprouty-related, EVH1 domain-containing protein 2; FLJ21897; FLJ31917; Spred 2; sprouty protein with EVH-1 domain 2, related sequence; Spred-2; MGC163164
• mRNA Refseq: NM_001128210
• Protein Refseq: NP_001121682
• MIM: 609292
• UniProt ID: Q7Z698
• Gene ID: 200734