Recombinant Human SPRED2 Protein, His tagged

• Cat.No.: SPRED2-001H
• Product Overview: Recombinant Human SPRED2 Protein (117-297 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 117-297 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• AA Sequence: MKAIEDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKYPDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 1 mg/mL by BCA

Gene Information

• Official Symbol: SPRED2
• Synonyms: SPRED2; sprouty-related, EVH1 domain containing 2; sprouty-related, EVH1 domain-containing protein 2; FLJ21897; FLJ31917; Spred 2; sprouty protein with EVH-1 domain 2, related sequence; Spred-2; MGC163164
• Gene ID: 200734
• mRNA Refseq: NM_001128210
• Protein Refseq: NP_001121682
• MIM: 609292
• UniProt ID: Q7Z698