Recombinant Human SPO11 protein, His-tagged

• Cat.No.: SPO11-3533H
• Product Overview: Recombinant Human SPO11 protein(Q9Y5K1)(1-396aa), fused with C-terminal His tag, was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 1-396aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI

Gene Information

• Gene Name: SPO11 SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SPO11
• Synonyms: SPO11; SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae); SPO11 meiotic protein covalently bound to DSB like (S. cerevisiae) , SPO11, meiotic protein covalently bound to DSB (S. cerevisiae) like; meiotic recombination protein SPO11; cancer/testis antigen 35; CT35; MGC39953
• Gene ID: 23626
• mRNA Refseq: NM_012444
• Protein Refseq: NP_036576
• MIM: 605114
• UniProt ID: Q9Y5K1