Recombinant Human SPN protein(281-360 aa), C-His-tagged

• Cat.No.: SPN-2663H
• Product Overview: Recombinant Human SPN protein(P16150)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 281-360 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SPN sialophorin [ Homo sapiens ]
• Official Symbol: SPN
• Synonyms: SPN; sialophorin; sialophorin (gpL115, leukosialin, CD43); leukosialin; CD43; GPL115; LSN; GALGP; galactoglycoprotein; leukocyte sialoglycoprotein; sialophorin (leukosialin, CD43)
• Gene ID: 6693
• mRNA Refseq: NM_001030288
• Protein Refseq: NP_001025459
• MIM: 182160
• UniProt ID: P16150