Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPIN4-2041H
Product Overview : SPIN4 MS Standard C13 and N15-labeled recombinant protein (NP_001012986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Exhibits H3K4me3-binding activity
Molecular Mass : 28.7 kDa
AA Sequence : MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPIN4 spindlin family member 4 [ Homo sapiens (human) ]
Official Symbol SPIN4
Synonyms SPIN4; spindlin family, member 4; TDRD28; spindlin-4
Gene ID 139886
mRNA Refseq NM_001012968
Protein Refseq NP_001012986
UniProt ID Q56A73

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPIN4 Products

Required fields are marked with *

My Review for All SPIN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon