Recombinant Human SPIN4 protein(36-249aa), GST-tagged
Cat.No. : | SPIN4-2474H |
Product Overview : | Recombinant Human SPIN4 protein(Q56A73)(36-249aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 36-249aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP |
Gene Name | SPIN4 spindlin family, member 4 [ Homo sapiens ] |
Official Symbol | SPIN4 |
Gene ID | 139886 |
mRNA Refseq | NM_001012968.2 |
Protein Refseq | NP_001012986.2 |
UniProt ID | Q56A73 |
◆ Recombinant Proteins | ||
SPIN4-5374H | Recombinant Human SPIN4 protein(36-249aa), His-tagged | +Inquiry |
SPIN4-0474H | Recombinant Human SPIN4 Protein (S2-P249), His tagged | +Inquiry |
SPIN4-15884M | Recombinant Mouse SPIN4 Protein | +Inquiry |
SPIN4-2041H | Recombinant Human SPIN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPIN4-0475H | Recombinant Human SPIN4 Protein (S2-P249), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPIN4-1512HCL | Recombinant Human SPIN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPIN4 Products
Required fields are marked with *
My Review for All SPIN4 Products
Required fields are marked with *
0
Inquiry Basket