Recombinant Human SPEF2 Protein, GST-tagged
Cat.No. : | SPEF2-4288H |
Product Overview : | Human FLJ23577 partial ORF ( NP_079143, 324 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SPEF2 (Sperm Flagellar 2) is a Protein Coding gene. GO annotations related to this gene include protein dimerization activity. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPEF2 sperm flagellar 2 [ Homo sapiens ] |
Official Symbol | SPEF2 |
Synonyms | SPEF2; sperm flagellar 2; sperm flagellar protein 2; cancer/testis antigen 122; CT122; FLJ23577; KPL2; FLJ23164; FLJ25395; KIAA1770; MGC102842; |
Gene ID | 79925 |
mRNA Refseq | NM_024867 |
Protein Refseq | NP_079143 |
MIM | 610172 |
UniProt ID | Q9C093 |
◆ Recombinant Proteins | ||
SPEF2-6807Z | Recombinant Zebrafish SPEF2 | +Inquiry |
SPEF2-3201H | Recombinant Human SPEF2 protein, His-tagged | +Inquiry |
SPEF2-4288H | Recombinant Human SPEF2 Protein, GST-tagged | +Inquiry |
SPEF2-8635M | Recombinant Mouse SPEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPEF2-15867M | Recombinant Mouse SPEF2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPEF2 Products
Required fields are marked with *
My Review for All SPEF2 Products
Required fields are marked with *
0
Inquiry Basket