Recombinant Human SPEF2 Protein, GST-tagged

• Cat.No.: SPEF2-4288H
• Product Overview: Human FLJ23577 partial ORF ( NP_079143, 324 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPEF2 (Sperm Flagellar 2) is a Protein Coding gene. GO annotations related to this gene include protein dimerization activity.
• Molecular Mass: 36.63 kDa
• AA Sequence: AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPEF2 sperm flagellar 2 [ Homo sapiens ]
• Official Symbol: SPEF2
• Synonyms: SPEF2; sperm flagellar 2; sperm flagellar protein 2; cancer/testis antigen 122; CT122; FLJ23577; KPL2; FLJ23164; FLJ25395; KIAA1770; MGC102842
• Gene ID: 79925
• mRNA Refseq: NM_024867
• Protein Refseq: NP_079143
• MIM: 610172
• UniProt ID: Q9C093