Recombinant Human SPAG16 protein, GST-tagged
Cat.No. : | SPAG16-6743H |
Product Overview : | Recombinant Human SPAG16 protein(1-181 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-181 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SPAG16 |
Synonyms | SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; DKFZp666P1710; FLJ22724; PF20; WDR29; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein; FLJ37717; MGC87036; |
Gene ID | 79582 |
mRNA Refseq | NM_001025436 |
Protein Refseq | NP_001020607 |
MIM | 612173 |
UniProt ID | Q8N0X2 |
◆ Recombinant Proteins | ||
SPAG16-1615H | Recombinant Human SPAG16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPAG16-2892H | Recombinant Human SPAG16 protein, His-tagged | +Inquiry |
SPAG16-4631H | Recombinant Human SPAG16 protein, GST-tagged | +Inquiry |
SPAG16-6743H | Recombinant Human SPAG16 protein, GST-tagged | +Inquiry |
SPAG16-704C | Recombinant Cynomolgus Monkey SPAG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAG16 Products
Required fields are marked with *
My Review for All SPAG16 Products
Required fields are marked with *
0
Inquiry Basket