Recombinant Human SPAG16 protein, His-tagged

• Cat.No.: SPAG16-2892H
• Product Overview: Recombinant Human SPAG16 protein(1-181 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-181 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SPAG16
• Synonyms: SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; DKFZp666P1710; FLJ22724; PF20; WDR29; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein; FLJ37717; MGC87036
• Gene ID: 79582
• mRNA Refseq: NM_001025436
• Protein Refseq: NP_001020607
• MIM: 612173
• UniProt ID: Q8N0X2