Recombinant Human SP1, His-tagged

• Cat.No.: SP1-30987TH
• Product Overview: Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 645-778 a.a.
• Description: The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Up-regulated in adenocarcinomas of the stomach (at protein level).
• Form: Lyophilised:Reconstitute with 148 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF
• Sequence Similarities: Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.

Gene Information

• Gene Name: SP1 Sp1 transcription factor [ Homo sapiens ]
• Official Symbol: SP1
• Synonyms: SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1
• Gene ID: 6667
• mRNA Refseq: NM_001251825
• Protein Refseq: NP_001238754
• MIM: 189906
• Uniprot ID: P08047
• Chromosome Location: 12q13.1
• Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem
• Function: DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding