Recombinant Human SOX7 protein, T7/His-tagged
Cat.No. : | SOX7-173H |
Product Overview : | Recombinant human Sox7 cDNA (387 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSASLLGAYPWPEGLECPALDAELSDGQSPPAVPRPPGDKGSESRI RRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK QAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVD TYPYGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSM MSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSA TGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYSVS |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | SOX7 SRY (sex determining region Y)-box 7 [ Homo sapiens ] |
Official Symbol | SOX7 |
Synonyms | SOX7; SRY (sex determining region Y)-box 7; transcription factor SOX-7; SOX7 transcription factor; MGC10895; |
Gene ID | 83595 |
mRNA Refseq | NM_031439 |
Protein Refseq | NP_113627 |
MIM | 612202 |
UniProt ID | Q9BT81 |
Chromosome Location | 8p22 |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
SOX7-2722H | Recombinant Human SOX7 Protein, His-tagged | +Inquiry |
SOX7-294H | Recombinant Human SOX7 Protein, His-tagged | +Inquiry |
SOX7-15786M | Recombinant Mouse SOX7 Protein | +Inquiry |
SOX7-5171Z | Recombinant Zebrafish SOX7 | +Inquiry |
SOX7-173H | Recombinant Human SOX7 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX7-1556HCL | Recombinant Human SOX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX7 Products
Required fields are marked with *
My Review for All SOX7 Products
Required fields are marked with *
0
Inquiry Basket