Recombinant Human SOX4 protein(91-170 aa), C-His-tagged

• Cat.No.: SOX4-2830H
• Product Overview: Recombinant Human SOX4 protein(Q06945)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 91-170 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SOX4 SRY (sex determining region Y)-box 4 [ Homo sapiens ]
• Official Symbol: SOX4
• Synonyms: SOX4; SRY (sex determining region Y)-box 4; transcription factor SOX-4; SRY-related HMG-box gene 4; ecotropic viral integration site 16; EVI16
• Gene ID: 6659
• mRNA Refseq: NM_003107
• Protein Refseq: NP_003098
• MIM: 184430
• UniProt ID: Q06945