Recombinant Human SOX4 protein(91-170 aa), C-His-tagged

Cat.No. : SOX4-2830H
Product Overview : Recombinant Human SOX4 protein(Q06945)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG
Gene Name SOX4 SRY (sex determining region Y)-box 4 [ Homo sapiens ]
Official Symbol SOX4
Synonyms SOX4; SRY (sex determining region Y)-box 4; transcription factor SOX-4; SRY-related HMG-box gene 4; ecotropic viral integration site 16; EVI16;
Gene ID 6659
mRNA Refseq NM_003107
Protein Refseq NP_003098
MIM 184430
UniProt ID Q06945

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOX4 Products

Required fields are marked with *

My Review for All SOX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon