Recombinant Human SOX15 protein, T7/His-tagged
Cat.No. : | SOX15-182H |
Product Overview : | Recombinant human Sox15 cDNA ( 232 aa, derived from BC000985 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLE KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRR KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDP RLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ] |
Official Symbol | SOX15 |
Synonyms | SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20; |
Gene ID | 6665 |
mRNA Refseq | NM_006942 |
Protein Refseq | NP_008873 |
MIM | 601297 |
UniProt ID | O60248 |
Chromosome Location | 17p12.3 |
Function | DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
SOX15-8588M | Recombinant Mouse SOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX15-95H | Recombinant Human SOX15 protein, His-tagged | +Inquiry |
SOX15-96H | Recombinant Human SOX15 protein, 61-140AA, C-His-tagged | +Inquiry |
SOX15-15777M | Recombinant Mouse SOX15 Protein | +Inquiry |
SOX15-182H | Recombinant Human SOX15 protein, T7/His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX15 Products
Required fields are marked with *
My Review for All SOX15 Products
Required fields are marked with *
0
Inquiry Basket