Recombinant Human SOX15 protein, T7/His-tagged
| Cat.No. : | SOX15-182H |
| Product Overview : | Recombinant human Sox15 cDNA ( 232 aa, derived from BC000985 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLE KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRR KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDP RLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ] |
| Official Symbol | SOX15 |
| Synonyms | SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20; |
| Gene ID | 6665 |
| mRNA Refseq | NM_006942 |
| Protein Refseq | NP_008873 |
| MIM | 601297 |
| UniProt ID | O60248 |
| Chromosome Location | 17p12.3 |
| Function | DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX15 Products
Required fields are marked with *
My Review for All SOX15 Products
Required fields are marked with *
0
Inquiry Basket
