Recombinant Human SOX15 protein, 61-140AA, C-His-tagged

• Cat.No.: SOX15-96H
• Product Overview: Recombinant Human SOX15 protein(O60248)(61-140aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Form: 0.15 M Phosphate buffered saline
• AA Sequence: SAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN
• Storage: 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80 °C
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SOX15 SRY (sex determining region Y)-box 15 [ Homo sapiens ]
• Official Symbol: SOX15
• Synonyms: SOX15; SRY (sex determining region Y)-box 15; SOX20, SRY (sex determining region Y) box 20; protein SOX-15; SOX26; SOX27; SRY (sex determining region Y)-box 20; SOX20
• Gene ID: 6665
• mRNA Refseq: NM_006942
• Protein Refseq: NP_008873
• MIM: 601297
• UniProt ID: O60248