Recombinant Human SORL1 protein, His-tagged

• Cat.No.: SORL1-801H
• Product Overview: Recombinant Human SORL1 protein(NP_003096)(1865-2214 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1865-2214 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SORL1 sortilin-related receptor, L(DLR class) A repeats containing [ Homo sapiens ]
• Official Symbol: SORL1
• Synonyms: SORL1; sortilin-related receptor, L(DLR class) A repeats containing; C11orf32, chromosome 11 open reading frame 32 , sortilin related receptor, L(DLR class) A repeats containing; sortilin-related receptor; gp250; LR11; LRP9; SorLA; SorLA 1; mosaic protein LR11; LDLR relative with 11 ligand-binding repeats; sortilin-related receptor, L(DLR class) A repeats-containing; sorting protein-related receptor containing LDLR class A repeats; low-density lipoprotein receptor relative with 11 ligand-binding repeats; SORLA; SorLA-1; C11orf32; FLJ21930; FLJ39258
• Gene ID: 6653
• mRNA Refseq: NM_003105
• Protein Refseq: NP_003096
• MIM: 602005
• UniProt ID: Q92673