Recombinant Human SORL1

• Cat.No.: SORL1-29617TH
• Product Overview: Recombinant fragment corresponding to amino acids 82-181 of Human SorLA with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Description: This gene encodes a mosaic protein that belongs to at least two families: the vacuolar protein sorting 10 (VPS10) domain-containing receptor family, and the low density lipoprotein receptor (LDLR) family. The encoded protein also contains fibronectin type III repeats and an epidermal growth factor repeat. The encoded protein is translated as a preproprotein and likely plays roles in endocytosis and sorting. There may be an association between expression of this locus and Alzheimers Disease.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. According to PubMed:9157966, found in spinal cord, testis, liver, kidney and pancreas with dete
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
• Sequence Similarities: Belongs to the SORL1 family.Contains 5 BNR repeats.Contains 1 EGF-like domain.Contains 6 fibronectin type-III domains.Contains 11 LDL-receptor class A domains.Contains 5 LDL-receptor class B repeats.
• Tag: Non

Gene Information

• Gene Name: SORL1 sortilin-related receptor, L(DLR class) A repeats containing [ Homo sapiens ]
• Official Symbol: SORL1
• Synonyms: SORL1; sortilin-related receptor, L(DLR class) A repeats containing; C11orf32, chromosome 11 open reading frame 32 , sortilin related receptor, L(DLR class) A repeats containing; sortilin-related receptor; gp250; LR11; LRP9; SorLA; SorLA 1
• Gene ID: 6653
• mRNA Refseq: NM_003105
• Protein Refseq: NP_003096
• MIM: 602005
• Uniprot ID: Q92673
• Chromosome Location: 11q23.2-q24.4
• Function: low-density lipoprotein particle binding; receptor activity; transmembrane signaling receptor activity