Recombinant Human SOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SOD2-2681H
• Product Overview: SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.8 kDa
• AA Sequence: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SOD2 superoxide dismutase 2 [ Homo sapiens (human) ]
• Official Symbol: SOD2
• Synonyms: SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6
• Gene ID: 6648
• mRNA Refseq: NM_001024465
• Protein Refseq: NP_001019636
• MIM: 147460
• UniProt ID: P04179