Recombinant Human SOD2 protein(25-222 aa), N-GST-tagged

• Cat.No.: SOD2-2541H
• Product Overview: Recombinant Human SOD2 protein(P04179)(25-222 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Protein length: 25-222 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ]
• Official Symbol: SOD2
• Synonyms: SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6
• Gene ID: 6648
• mRNA Refseq: NM_000636
• Protein Refseq: NP_000627
• MIM: 147460
• UniProt ID: P04179