Active Recombinant Human superoxide dismutase 2 Protein, His tagged
Cat.No. : | SOD2-30343TH |
Product Overview : | Active recombinant human SOD2 protein was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-222 aa |
Description : | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. |
Form : | Liquid |
Molecular Mass : | 24.4 kDa (219aa) confirmed by MALDI-TOF |
AA Sequence : | < MGSSHHHHHHSSGLVPRGSHM> KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
Bio-Activity : | Specific activity is > 1,000 unit/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50 % in a coupled system, using xanthine and Xanthine oxidase at pH 7.5 at 25 centigrade. |
Purity : | > 95 % by SDS-PAGE |
Applications : | SDS-PAGE, Enzyme Activity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Reference : | 1. MacMillan-Crow L.A., et al. (1999) Arch. Biochem. Biophys. 366:82-88 2. Prunotto M, et al. (2010) J Am Soc Nephrol. 21(3):507-19. |
Gene Name | SOD2 superoxide dismutase 2 [ Homo sapiens (human) ] |
Official Symbol | SOD2 |
Synonyms | SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6 |
Gene ID | 6648 |
mRNA Refseq | NM_000636 |
Protein Refseq | NP_001019636 |
MIM | 147460 |
UniProt ID | P04179 |
◆ Recombinant Proteins | ||
SOD2-4406R | Recombinant Rhesus monkey SOD2 Protein, His-tagged | +Inquiry |
SOD2-15750M | Recombinant Mouse SOD2 Protein | +Inquiry |
SOD2-738H | Recombinant Human SOD2, MYC-DDK-tagged | +Inquiry |
SOD2-1039H | Recombinant Human SOD2 | +Inquiry |
SOD2-5667R | Recombinant Rat SOD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOD2 Products
Required fields are marked with *
My Review for All SOD2 Products
Required fields are marked with *
0
Inquiry Basket