Recombinant Human SOAT1

• Cat.No.: SOAT1-31430TH
• Product Overview: Recombinant fragment of Human SOAT 1 with N terminal proprietary tag, predicted mwt: 33.66 kDa.

Specification

• Description: Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al.
• Protein length: 73 amino acids
• Molecular Weight: 33.660kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG
• Sequence Similarities: Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
• Tag: Non

Gene Information

• Gene Name: SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ]
• Official Symbol: SOAT1
• Synonyms: SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase
• Gene ID: 6646
• mRNA Refseq: NM_003101
• Protein Refseq: NP_003092
• MIM: 102642
• Uniprot ID: P35610
• Chromosome Location: 1q25
• Pathway: Statin Pathway, organism-specific biosystem; Steroid biosynthesis, organism-specific biosystem; Steroid biosynthesis, conserved biosystem
• Function: cholesterol O-acyltransferase activity; cholesterol O-acyltransferase activity; cholesterol binding; fatty-acyl-CoA binding; sterol O-acyltransferase activity