Recombinant Human SNX32 protein, GST-tagged
Cat.No. : | SNX32-301157H |
Product Overview : | Recombinant Human SNX32 (218-285 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His218-Glu285 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SNX32 sorting nexin 32 [ Homo sapiens ] |
Official Symbol | SNX32 |
Synonyms | SNX32; sorting nexin 32; SNX6B, sorting nexin 6B; sorting nexin-32; FLJ30934; sorting nexin 6B; sorting nexin-6B; SNX6B; MGC42112; MGC57276; DKFZp761P1320; |
Gene ID | 254122 |
mRNA Refseq | NM_152760 |
Protein Refseq | NP_689973 |
UniProt ID | Q86XE0 |
◆ Recombinant Proteins | ||
SNX32-4300H | Recombinant Human SNX32 Protein, GST-tagged | +Inquiry |
SNX32-8557M | Recombinant Mouse SNX32 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX32-4990HF | Recombinant Full Length Human SNX32 Protein, GST-tagged | +Inquiry |
SNX32-15733M | Recombinant Mouse SNX32 Protein | +Inquiry |
SNX32-301157H | Recombinant Human SNX32 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX32-1590HCL | Recombinant Human SNX32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX32 Products
Required fields are marked with *
My Review for All SNX32 Products
Required fields are marked with *
0
Inquiry Basket