Recombinant Human SNX32 protein, GST-tagged

• Cat.No.: SNX32-301157H
• Product Overview: Recombinant Human SNX32 (218-285 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: His218-Glu285
• AA Sequence: HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SNX32 sorting nexin 32 [ Homo sapiens ]
• Official Symbol: SNX32
• Synonyms: SNX32; sorting nexin 32; SNX6B, sorting nexin 6B; sorting nexin-32; FLJ30934; sorting nexin 6B; sorting nexin-6B; SNX6B; MGC42112; MGC57276; DKFZp761P1320
• Gene ID: 254122
• mRNA Refseq: NM_152760
• Protein Refseq: NP_689973
• UniProt ID: Q86XE0