Recombinant Full Length Human SNX32 Protein, GST-tagged

• Cat.No.: SNX32-4990HF
• Product Overview: Human FLJ30934 full-length ORF ( NP_689973.2, 1 a.a. - 403 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SNX32 (Sorting Nexin 32) is a Protein Coding gene. Among its related pathways are Endocytosis. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX6.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 72.8 kDa
• Protein length: 403 amino acids
• AA Sequence: METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SNX32 sorting nexin 32 [ Homo sapiens ]
• Official Symbol: SNX32
• Synonyms: SNX32; sorting nexin 32; SNX6B, sorting nexin 6B; sorting nexin-32; FLJ30934; sorting nexin 6B; sorting nexin-6B; SNX6B; MGC42112; MGC57276; DKFZp761P1320
• Gene ID: 254122
• mRNA Refseq: NM_152760
• Protein Refseq: NP_689973
• UniProt ID: Q86XE0