Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNRPC-2822H
• Product Overview: SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
• Molecular Mass: 17.2 kDa
• AA Sequence: MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens (human) ]
• Official Symbol: SNRPC
• Synonyms: SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1; U1 snRNP C; U1 snRNP protein C; U1 small nuclear RNP specific C; U1C; FLJ20302
• Gene ID: 6631
• mRNA Refseq: NM_003093
• Protein Refseq: NP_003084
• MIM: 603522
• UniProt ID: P09234