Recombinant Human SNRPB2 Protein (1-225 aa), His-SUMO-tagged

Cat.No. : SNRPB2-959H
Product Overview : Recombinant Human SNRPB2 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-225 aa
Description : Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds st loop IV of U2 snRNA only in presence of the U2A' protein.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 41.5 kDa
AA Sequence : MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name SNRPB2 small nuclear ribonucleoprotein polypeptide B [ Homo sapiens ]
Official Symbol SNRPB2
Synonyms SNRPB2; Msl1; U2 snRNP B; MGC24807; MGC45309;
Gene ID 6629
mRNA Refseq NM_003092
Protein Refseq NP_003083
MIM 603520
UniProt ID P08579

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNRPB2 Products

Required fields are marked with *

My Review for All SNRPB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon