Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNCA-6456H
• Product Overview: SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.3 kDa
• AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNCA synuclein alpha [ Homo sapiens (human) ]
• Official Symbol: SNCA
• Synonyms: SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988
• Gene ID: 6622
• mRNA Refseq: NM_000345
• Protein Refseq: NP_000336
• MIM: 163890
• UniProt ID: P37840