Recombinant Human SNCA Protein

Description :	SNCA is associated with human neurodegenerative diseases, where it forms aggregates in nerve tissues. Diseases include Parkinson’s disease, dementia with lewy bodies, and multi-system atrophy, but also other’s disease like Alzheimer’s Disease. Lewy Bodies are well-known cytoplasmic deposits of SNCA in Parkinson’s disease.
Source :	E. coli
Species :	Human
Form :	Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 2.5 mg/ml
Molecular Mass :	14604 kg/mol
Protein length :	1-140 aa
AA Sequence :	GSMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity :	> 98% by SDS-PAGE
Notes :	Thawing: Gentle agitation at 37 centigrade. Refreezing is not recommended and should be avoided.
Storage :	Store at -80 centigrade
Concentration :	2.5 mg/ml
Tag :	Non

Gene Name	SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ]
Official Symbol	SNCA
Synonyms	SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988;
Gene ID	6622
mRNA Refseq	NM_000345
Protein Refseq	NP_000336
MIM	163890
UniProt ID	P37840