Recombinant Human SMYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMYD2-3479H
Product Overview : SMYD2 MS Standard C13 and N15-labeled recombinant protein (NP_064582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SET domain-containing proteins, such as SMYD2, catalyze lysine methylation.
Molecular Mass : 49.5 kDa
AA Sequence : MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMYD2 SET and MYND domain containing 2 [ Homo sapiens (human) ]
Official Symbol SMYD2
Synonyms SMYD2; SET and MYND domain containing 2; N-lysine methyltransferase SMYD2; HSKM B; KMT3C; ZMYND14; lysine N-methyltransferase 3C; histone methyltransferase SMYD2; zinc finger, MYND domain containing 14; SET and MYND domain-containing protein 2; HSKM-B; MGC119305;
Gene ID 56950
mRNA Refseq NM_020197
Protein Refseq NP_064582
MIM 610663
UniProt ID Q9NRG4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMYD2 Products

Required fields are marked with *

My Review for All SMYD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon