Recombinant Human SMYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMYD2-3479H |
Product Overview : | SMYD2 MS Standard C13 and N15-labeled recombinant protein (NP_064582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SET domain-containing proteins, such as SMYD2, catalyze lysine methylation. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMYD2 SET and MYND domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | SMYD2 |
Synonyms | SMYD2; SET and MYND domain containing 2; N-lysine methyltransferase SMYD2; HSKM B; KMT3C; ZMYND14; lysine N-methyltransferase 3C; histone methyltransferase SMYD2; zinc finger, MYND domain containing 14; SET and MYND domain-containing protein 2; HSKM-B; MGC119305; |
Gene ID | 56950 |
mRNA Refseq | NM_020197 |
Protein Refseq | NP_064582 |
MIM | 610663 |
UniProt ID | Q9NRG4 |
◆ Recombinant Proteins | ||
SMYD2-2828H | Recombinant Human SMYD2, His-tagged | +Inquiry |
SMYD2-5289R | Recombinant Rat SMYD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMYD2-6967H | Recombinant Human SMYD2, GST-tagged | +Inquiry |
SMYD2-049H | Active Recombinant Human SMYD2 Protein, His/SUMO-tagged | +Inquiry |
SMYD2-15656M | Recombinant Mouse SMYD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMYD2-705HCL | Recombinant Human SMYD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMYD2 Products
Required fields are marked with *
My Review for All SMYD2 Products
Required fields are marked with *
0
Inquiry Basket