Recombinant Human SMOC1 protein, His-GST-tagged

• Cat.No.: SMOC1-4564H
• Product Overview: Recombinant Human SMOC1 protein(Q9H4F8)(277-382aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.2 kDa
• Protein length: 277-382aa
• AA Sequence: GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SMOC1 SPARC related modular calcium binding 1 [ Homo sapiens ]
• Official Symbol: SMOC1
• Synonyms: SMOC1; SPARC related modular calcium binding 1; SPARC-related modular calcium-binding protein 1; secreted modular calcium-binding protein 1; OAS
• Gene ID: 64093
• mRNA Refseq: NM_001034852
• Protein Refseq: NP_001030024
• MIM: 608488
• UniProt ID: Q9H4F8