Recombinant Human SMAD7 protein, His-tagged

Cat.No. : SMAD7-561H
Product Overview : Recombinant Human SMAD7 protein(NP_001177750)(1-426 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-426 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SMAD7 SMAD family member 7 [ Homo sapiens ]
Official Symbol SMAD7
Synonyms SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7; hSMAD7; MAD homolog 8; mothers against DPP homolog 8; SMAD, mothers against DPP homolog 7; Mothers against decapentaplegic, drosophila, homolog of, 7; MAD (mothers against decapentaplegic, Drosophila) homolog 7; CRCS3; MADH7; MADH8; FLJ16482;
Gene ID 4092
mRNA Refseq NM_001190821
Protein Refseq NP_001177750
MIM 602932
UniProt ID O15105

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMAD7 Products

Required fields are marked with *

My Review for All SMAD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon