Recombinant Human SMAD7

Cat.No. : SMAD7-29105TH
Product Overview : Recombinant fragment of Human MADH7 with N terminal proprietary tag, 36.74kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.740kDa inclusive of tags
Tissue specificity : Ubiquitous with higher expression in the lung and vascular endothelium.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLS RLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTN YLAPGGLSDSQLLLEPGDRSH
Sequence Similarities : Belongs to the dwarfin/SMAD family.Contains 1 MH1 (MAD homology 1) domain.Contains 1 MH2 (MAD homology 2) domain.
Gene Name SMAD7 SMAD family member 7 [ Homo sapiens ]
Official Symbol SMAD7
Synonyms SMAD7; SMAD family member 7; MAD, mothers against decapentaplegic homolog 7 (Drosophila) , MADH7, MADH8, SMAD, mothers against DPP homolog 7 (Drosophila); mothers against decapentaplegic homolog 7;
Gene ID 4092
mRNA Refseq NM_001190821
Protein Refseq NP_001177750
MIM 602932
Uniprot ID O15105
Chromosome Location 18q21.1
Pathway ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; IFN-gamma pathway, organism-specific biosystem;
Function I-SMAD binding; activin binding; beta-catenin binding; collagen binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMAD7 Products

Required fields are marked with *

My Review for All SMAD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon