Recombinant Human SLURP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SLURP1-3135H
• Product Overview: SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.2 kDa
• AA Sequence: MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: SLURP1
• Synonyms: SLURP1; secreted LY6/PLAUR domain containing 1; secreted Ly-6/uPAR-related protein 1; ANUP; ARS; ARS component B; ArsB; LY6LS; lymphocyte antigen 6 like secreted; MDM; SLURP-1; ARS(component B)-81/S; anti-neoplastic urinary protein; lymphocyte antigen 6-like secreted; secreted Ly6/uPAR related protein 1
• Gene ID: 57152
• mRNA Refseq: NM_020427
• Protein Refseq: NP_065160
• MIM: 606119
• UniProt ID: P55000