Recombinant Human SLURP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SLURP1-3135H |
Product Overview : | SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | SLURP1 |
Synonyms | SLURP1; secreted LY6/PLAUR domain containing 1; secreted Ly-6/uPAR-related protein 1; ANUP; ARS; ARS component B; ArsB; LY6LS; lymphocyte antigen 6 like secreted; MDM; SLURP-1; ARS(component B)-81/S; anti-neoplastic urinary protein; lymphocyte antigen 6-like secreted; secreted Ly6/uPAR related protein 1; |
Gene ID | 57152 |
mRNA Refseq | NM_020427 |
Protein Refseq | NP_065160 |
MIM | 606119 |
UniProt ID | P55000 |
◆ Recombinant Proteins | ||
Slurp1-1953M | Recombinant Mouse Slurp1 protein, His & GST-tagged | +Inquiry |
Slurp1-5947M | Recombinant Mouse Slurp1 Protein, Myc/DDK-tagged | +Inquiry |
SLURP1-132H | Recombinant Human SLURP1 protein, MYC/DDK-tagged | +Inquiry |
SLURP1-2933HFL | Recombinant Full Length Human SLURP1 protein, Flag-tagged | +Inquiry |
SLURP1-801HFL | Recombinant Full Length Human SLURP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLURP1-1642HCL | Recombinant Human SLURP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLURP1 Products
Required fields are marked with *
My Review for All SLURP1 Products
Required fields are marked with *
0
Inquiry Basket