Recombinant Full Length Human SLURP1 Protein, C-Flag-tagged

• Cat.No.: SLURP1-801HFL
• Product Overview: Recombinant Full Length Human SLURP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 8.9 kDa
• AA Sequence: MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT
  RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: SLURP1
• Synonyms: ARS; MDM; ANUP; ArsB; LY6LS; LY6-MT
• Gene ID: 57152
• mRNA Refseq: NM_020427.3
• Protein Refseq: NP_065160.1
• MIM: 606119
• UniProt ID: P55000