Recombinant Human SLC8A1 protein, GST-tagged

• Cat.No.: SLC8A1-301560H
• Product Overview: Recombinant Human SLC8A1 (41-59 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Val59
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC8A1 solute carrier family 8 (sodium/calcium exchanger), member 1 [ Homo sapiens ]
• Official Symbol: SLC8A1
• Synonyms: NCX1
• Gene ID: 6546
• mRNA Refseq: NM_021097.2
• Protein Refseq: NP_066920.1
• MIM: 182305
• UniProt ID: P32418