Recombinant Human SLC7A11 Protein, His-tagged
Cat.No. : | SLC7A11-01H |
Product Overview : | Recombinant Human SLC7A11 Protein with a N-terminal 10xHis tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death. |
Form : | Lyophilized |
Molecular Mass : | ~ 58.2 kDa |
AA Sequence : | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
Purity : | ≥90%, by SDS-PAGE |
Stability : | -20 to -80 centigrade, six months from the date of receipt |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | 20 mM Tris-HCl, 0.15M NaCl, 0.05% Brij78, 6% Trehalose, pH 8.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/ml. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 centigrade/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC7A11 solute carrier family 7 member 11 [ Homo sapiens (human) ] |
Official Symbol | SLC7A11 |
Synonyms | SLC7A11; solute carrier family 7 member 11; xCT; CCBR1; cystine/glutamate transporter; amino acid transport system xc-; calcium channel blocker resistance protein CCBR1; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 |
Gene ID | 23657 |
mRNA Refseq | NM_014331 |
Protein Refseq | NP_055146 |
MIM | 607933 |
UniProt ID | Q9UPY5 |
◆ Recombinant Proteins | ||
RFL33376HF | Recombinant Human Cystine/Glutamate Transporter(Slc7A11) Protein, His-Tagged | +Inquiry |
SLC7A11-6253H | Recombinant Human SLC7A11 protein, His-tagged | +Inquiry |
SLC7A11-481HF | Recombinant Full Length Human SLC7A11 Protein, GST-tagged | +Inquiry |
SLC7A11-4127R | Recombinant Rhesus Macaque SLC7A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A11-301456H | Recombinant Human SLC7A11 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC7A11 Products
Required fields are marked with *
My Review for All SLC7A11 Products
Required fields are marked with *
0
Inquiry Basket