Recombinant Human SLC7A11 Protein

• Cat.No.: SLC7A11-11H
• Product Overview: Recombinant Human SLC7A11 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death.
• Molecular Mass: The protein has a calculated MW of 58 kDa, it is speculated that the protein forms a dimeric structure (116 kDa).
• AA Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.85 mg/mL
• Storage Buffer: 20 mM Tris-HCl, 0.15M NaCl, 0.05%Brij-78,pH 8.0, 10% glycerol

Gene Information

• Gene Name: SLC7A11 solute carrier family 7 member 11 [ Homo sapiens (human) ]
• Official Symbol: SLC7A11
• Synonyms: SLC7A11; solute carrier family 7 member 11; xCT; CCBR1; cystine/glutamate transporter; amino acid transport system xc-; calcium channel blocker resistance protein CCBR1; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
• Gene ID: 23657
• mRNA Refseq: NM_014331
• Protein Refseq: NP_055146
• MIM: 607933
• UniProt ID: A8K2U4