Recombinant Human SLC7A11 protein, GST-tagged

• Cat.No.: SLC7A11-30700TH
• Product Overview: Recombinant Human SLC7A11(1 a.a. - 501 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-501 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 81.8 kDa
• AA Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ]
• Official Symbol: SLC7A11
• Synonyms: SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1
• Gene ID: 23657
• mRNA Refseq: NM_014331
• Protein Refseq: NP_055146
• MIM: 607933
• UniProt ID: Q9UPY5
• Chromosome Location: 4q28-q32
• Function: amino acid transmembrane transporter activity; cystine:glutamate antiporter activity; protein binding