Recombinant Human SLC6A5 protein, GST-tagged

• Cat.No.: SLC6A5-118H
• Product Overview: Recombinant Human SLC6A5(294 a.a. - 393 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFV SGSEEYFKYFVLKISAGIEYPGEIR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 294-393 a.a.

Gene Information

• Gene Name: SLC6A5 solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [ Homo sapiens ]
• Official Symbol: SLC6A5
• Synonyms: SLC6A5; solute carrier family 6 (neurotransmitter transporter, glycine), member 5; NET1; sodium- and chloride-dependent glycine transporter 2; GLYT2; GLYT-2
• Gene ID: 9152
• mRNA Refseq: NM_004211
• Protein Refseq: NP_004202
• MIM: 604159
• UniProt ID: Q9Y345
• Chromosome Location: 11p15.1
• Pathway: Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem
• Function: glycine:sodium symporter activity; neurotransmitter:sodium symporter activity; symporter activity