Recombinant Human SLC5A5 protein, His-tagged

• Cat.No.: SLC5A5-743H
• Product Overview: Recombinant Human SLC5A5 protein(Q92911)(547-643aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 547-643a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Gene Information

• Gene Name: SLC5A5 solute carrier family 5 (sodium iodide symporter), member 5 [ Homo sapiens ]
• Official Symbol: SLC5A5
• Synonyms: SLC5A5; solute carrier family 5 (sodium iodide symporter), member 5; sodium/iodide cotransporter; NIS; Na(+)/I(-) symporter; Na(+)/I(-) cotransporter; TDH1
• Gene ID: 6528
• mRNA Refseq: NM_000453
• Protein Refseq: NP_000444
• MIM: 601843
• UniProt ID: Q92911