Recombinant Human SLC4A1 protein, His-SUMO & Myc-tagged
Cat.No. : | SLC4A1-3500H |
Product Overview : | Recombinant Human SLC4A1 protein(P02730)(1-403aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-403aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 65.3 kDa |
AA Sequence : | MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLC4A1 solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) [ Homo sapiens ] |
Official Symbol | SLC4A1 |
Synonyms | SLC4A1; solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); AE1, DI, EPB3, Waldner blood group , WD; band 3 anion transport protein; CD233; FR; Froese blood group; RTA1A; SW; Swann blood group; WR; Wright blood group; anion exchanger 1; anion exchanger-1; Waldner blood group; anion exchange protein 1; erythroid anion exchange protein; erythrocyte membrane protein band 3; solute carrier family 4, anion exchanger, number 1; DI; WD; AE1; WD1; BND3; EPB3; EMPB3; MGC116750; MGC116753; MGC126619; MGC126623; |
Gene ID | 6521 |
mRNA Refseq | NM_000342 |
Protein Refseq | NP_000333 |
UniProt ID | P02730 |
◆ Recombinant Proteins | ||
SLC4A1-3500H | Recombinant Human SLC4A1 protein, His-SUMO & Myc-tagged | +Inquiry |
SLC4A1-26065TH | Recombinant Human SLC4A1 | +Inquiry |
SLC4A1-89HFL | Recombinant Full Length Human SLC4A1 Protein, C-Flag-tagged | +Inquiry |
SLC4A1-2033H | Recombinant Human SLC4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC4A1-15465M | Recombinant Mouse SLC4A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC4A1-1635HCL | Recombinant Human SLC4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC4A1 Products
Required fields are marked with *
My Review for All SLC4A1 Products
Required fields are marked with *
0
Inquiry Basket