Recombinant Human SLC4A1
Cat.No. : | SLC4A1-26065TH |
Product Overview : | Recombinant fragment corresponding to amino acids 261-360 of Human Band 3, with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag NP. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Erythrocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK |
Sequence Similarities : | Belongs to the anion exchanger (TC 2.A.31) family. |
Gene Name | SLC4A1 solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) [ Homo sapiens ] |
Official Symbol | SLC4A1 |
Synonyms | SLC4A1; solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); AE1, DI, EPB3, Waldner blood group , WD; band 3 anion transport protein; CD233; FR; Froese blood group; RTA1A; SW; Swann blood group; WR; |
Gene ID | 6521 |
mRNA Refseq | NM_000342 |
Protein Refseq | NP_000333 |
Uniprot ID | P02730 |
Chromosome Location | 17q12-q21 |
Pathway | Bicarbonate transporters, organism-specific biosystem; Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | actin binding; anion transmembrane transporter activity; anion:anion antiporter activity; ankyrin binding; chloride transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC4A1-15465M | Recombinant Mouse SLC4A1 Protein | +Inquiry |
Slc4a1-1794R | Recombinant Rat Slc4a1 protein, His-tagged | +Inquiry |
SLC4A1-3500H | Recombinant Human SLC4A1 protein, His-SUMO & Myc-tagged | +Inquiry |
SLC4A1-3717H | Recombinant Human SLC4A1 protein, His-tagged | +Inquiry |
SLC4A1-8387M | Recombinant Mouse SLC4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC4A1-1635HCL | Recombinant Human SLC4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC4A1 Products
Required fields are marked with *
My Review for All SLC4A1 Products
Required fields are marked with *
0
Inquiry Basket