Recombinant Human SLC38A4 protein, His-tagged

• Cat.No.: SLC38A4-6744H
• Product Overview: Recombinant Human SLC38A4 protein(1-77 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-77 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEHHPGTTSF
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SLC38A4 solute carrier family 38, member 4 [ Homo sapiens ]
• Official Symbol: SLC38A4
• Synonyms: SLC38A4; solute carrier family 38, member 4; sodium-coupled neutral amino acid transporter 4; ATA3; NAT3; PAAT; amino acid transporter A3; N amino acid transporter 3; amino acid transporter system A3; system A amino acid transporter 3; system N amino acid transporter 3; Na(+)-coupled neutral amino acid transporter 4; FLJ10191; MGC126876
• mRNA Refseq: NM_001143824
• Protein Refseq: NP_001137296
• MIM: 608065
• UniProt ID: Q969I6
• Gene ID: 55089