Recombinant Human SLC37A1 protein, His-tagged

• Cat.No.: SLC37A1-2528H
• Product Overview: Recombinant Human SLC37A1 protein(247-336 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 247-336 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC37A1 solute carrier family 37 (glycerol-3-phosphate transporter), member 1 [ Homo sapiens ]
• Official Symbol: SLC37A1
• Synonyms: SLC37A1; solute carrier family 37 (glycerol-3-phosphate transporter), member 1; glycerol-3-phosphate transporter; G-3-P permease; G-3-P transporter; glycerol-3-phosphate permease; solute carrier family 37 member 1; G3PP; FLJ22340
• Gene ID: 54020
• mRNA Refseq: NM_018964
• Protein Refseq: NP_061837
• MIM: 608094
• UniProt ID: P57057