Recombinant Full Length Human DAB2 Protein, C-Flag-tagged
Cat.No. : | DAB2-1985HFL |
Product Overview : | Recombinant Full Length Human DAB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 82.3 kDa |
AA Sequence : | MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK DISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPVVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | DAB2 DAB adaptor protein 2 [ Homo sapiens (human) ] |
Official Symbol | DAB2 |
Synonyms | DOC2; DOC-2 |
Gene ID | 1601 |
mRNA Refseq | NM_001343.4 |
Protein Refseq | NP_001334.2 |
MIM | 601236 |
UniProt ID | P98082 |
◆ Recombinant Proteins | ||
DAB2-3554H | Recombinant Human DAB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DAB2-1985HFL | Recombinant Full Length Human DAB2 Protein, C-Flag-tagged | +Inquiry |
DAB2-714H | Recombinant Human DAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAB2-1768R | Recombinant Rat DAB2 Protein | +Inquiry |
DAB2-2192M | Recombinant Mouse DAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAB2-7086HCL | Recombinant Human DAB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAB2 Products
Required fields are marked with *
My Review for All DAB2 Products
Required fields are marked with *
0
Inquiry Basket