Recombinant Human SLC25A33 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SLC25A33-2990H
Product Overview : SLC25A33 MS Standard C13 and N15-labeled recombinant protein (NP_115691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins.
Molecular Mass : 35.4 kDa
AA Sequence : MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SLC25A33 solute carrier family 25 member 33 [ Homo sapiens (human) ]
Official Symbol SLC25A33
Synonyms SLC25A33; solute carrier family 25 member 33; PNC1; BMSC-MCP; solute carrier family 25 member 33; bone marrow stromal cell mitochondrial carrier protein; huBMSC-MCP; mitochondrial carrier protein; novel mitochondrial carrier protein; solute carrier family 25 (pyrimidine nucleotide carrier), member 33
Gene ID 84275
mRNA Refseq NM_032315
Protein Refseq NP_115691
MIM 610816
UniProt ID Q9BSK2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC25A33 Products

Required fields are marked with *

My Review for All SLC25A33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon