Recombinant Human SLC19A1 protein, His&Myc-tagged

• Cat.No.: SLC19A1-4242H
• Product Overview: Recombinant Human SLC19A1 protein(P41440)(420-591aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 420-591aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.5 kDa
• AASequence: DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC19A1 solute carrier family 19 (folate transporter), member 1 [ Homo sapiens ]
• Official Symbol: SLC19A1
• Synonyms: SLC19A1; solute carrier family 19 (folate transporter), member 1; folate transporter 1; FOLT; RFC; IFC-1; intestinal folate carrier 1; placental folate transporter; reduced folate carrier protein; solute carrier family 19 member 1; CHMD; IFC1; REFC; RFC1
• Gene ID: 6573
• mRNA Refseq: NM_001205206
• Protein Refseq: NP_001192135
• MIM: 600424
• UniProt ID: P41440