Recombinant Human SLC12A5 protein, GST-tagged

Cat.No. : SLC12A5-301559H
Product Overview : Recombinant Human SLC12A5 (915-1043 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ile915-Asn1043
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC12A5 solute carrier family 12 (potassium/chloride transporter), member 5 [ Homo sapiens ]
Official Symbol SLC12A5
Synonyms SLC12A5; solute carrier family 12 (potassium/chloride transporter), member 5; solute carrier family 12 member 5; KCC2; KIAA1176; hKCC2; K-Cl cotransporter 2; neuronal K-Cl cotransporter; erythroid K-Cl cotransporter 2; electroneutral potassium-chloride cotransporter 2;
Gene ID 57468
mRNA Refseq NM_001134771
Protein Refseq NP_001128243
MIM 606726
UniProt ID Q9H2X9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC12A5 Products

Required fields are marked with *

My Review for All SLC12A5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon