Recombinant Human SLC12A5 protein, GST-tagged

• Cat.No.: SLC12A5-301559H
• Product Overview: Recombinant Human SLC12A5 (915-1043 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ile915-Asn1043
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC12A5 solute carrier family 12 (potassium/chloride transporter), member 5 [ Homo sapiens ]
• Official Symbol: SLC12A5
• Synonyms: SLC12A5; solute carrier family 12 (potassium/chloride transporter), member 5; solute carrier family 12 member 5; KCC2; KIAA1176; hKCC2; K-Cl cotransporter 2; neuronal K-Cl cotransporter; erythroid K-Cl cotransporter 2; electroneutral potassium-chloride cotransporter 2
• Gene ID: 57468
• mRNA Refseq: NM_001134771
• Protein Refseq: NP_001128243
• MIM: 606726
• UniProt ID: Q9H2X9