Recombinant Human SLC11A1 protein, GST-tagged

• Cat.No.: SLC11A1-1264H
• Product Overview: Recombinant Human SLC11A1(1 a.a. - 178 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-178 a.a.
• Description: This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 45.6 kDa
• AA Sequence: MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLC11A1 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1 [ Homo sapiens ]
• Official Symbol: SLC11A1
• Synonyms: SLC11A1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1; LSH, NRAMP, NRAMP1; natural resistance-associated macrophage protein 1; natural resistance associated macrophage protein 1; NRAMP 1; solute carrier family 11 (sodium/phosphate symporters), member 1; LSH; NRAMP; NRAMP1
• Gene ID: 6556
• mRNA Refseq: NM_000578
• Protein Refseq: NP_000569
• MIM: 600266
• UniProt ID: P49279
• Chromosome Location: 2q35
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metal ion SLC transporters, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem
• Function: manganese ion transmembrane transporter activity; metal ion:hydrogen antiporter activity; molecular_function; protein homodimerization activity; transition metal ion transmembrane transporter activity; transporter activity